PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02659.1.p
Common NameEUGRSUZ_K02659, LOC104426104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 307aa    MW: 32680.6 Da    PI: 7.5841
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02659.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.42.5e-11653347
                      SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqky 47
                       W+ eEd+ + +a++++  +     W++Ia++++ g++l+++k+++q++
  Eucgr.K02659.1.p  6 EWSREEDKAFENAIAMHWVEdskePWDKIASMVP-GKSLEELKLHYQML 53
                      7****************99999999*********.************86 PP

2Myb_DNA-binding38.92e-12135179347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  Eucgr.K02659.1.p 135 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 179
                       7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.395258IPR017884SANT domain
SMARTSM007171.2E-7356IPR001005SANT/Myb domain
PfamPF002495.3E-8653IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-5654IPR009057Homeodomain-like
CDDcd001679.09E-10654No hitNo description
SuperFamilySSF466895.24E-9660IPR009057Homeodomain-like
PROSITE profilePS5129417.282127184IPR017930Myb domain
SuperFamilySSF466897.9E-17130185IPR009057Homeodomain-like
SMARTSM007172.3E-10132182IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.3E-17132182IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-11133178IPR009057Homeodomain-like
CDDcd001671.06E-9135180No hitNo description
PfamPF002497.6E-11135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSALEWSRE EDKAFENAIA MHWVEDSKEP WDKIASMVPG KSLEELKLHY QMLVDDVNAI  60
DAGQIQVPNY VSDETSSSSA AKDGPGFAGG GGGSAGDKRS NCGYGGGFSG LSHESGGHGG  120
KGGSRSDQER RKGIPWTEEE HRLFLLGLDK FGKGDWRSIS RNFVISRTPT QVASHAQKYF  180
IRLNSMNRDR RRSSIHDITS VNNGDVSTPQ APITGQQANP NPASVPAIGA SLKHRAHQPH  240
MPPGVGVYGA PVGHPIAAPP GHIGSAVGTP VMLPPPGHHP HPPYMVPMAY PMPPPPPPPL  300
PPPNHQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02659.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037352.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A059A5W50.0A0A059A5W5_EUCGR; Uncharacterized protein
STRINGVIT_17s0000g04130.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.15e-64MYB family protein